PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00092.1.g00470.1.am.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family HD-ZIP
Protein Properties Length: 659aa    MW: 71730.6 Da    PI: 7.9372
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00092.1.g00470.1.am.mkhcgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.21.4e-182683457
                                    -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
                        Homeobox  4 RttftkeqleeLeelFeknrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                                      ++t+eq+e+Le+++ ++++ps  +r++L +++    +++ +q+kvWFqNrR +ek+
  Zpz_sc00092.1.g00470.1.am.mkhc 26 YVRYTPEQVEALERVYSECPKPSSLRRQQLIRECpilsNIEPKQIKVWFQNRRCREKQ 83
                                    6789****************************************************97 PP

2START253.9e-09174231259
                                     HHHHHHHHHHHHHHHC-TT-EEEEEXCCTTEEEEEEESSS.SCEEEEEEEECCSCHHH CS
                           START   2 laeeaaqelvkkalaeepgWvkssesengdevlqkfeeskvdsgealrasgvvdmvla 59 
                                     +aee+++e+++ka+ ++  Wv+++ +++g++++ +++ s+++sg a+ra+g+v  +++
  Zpz_sc00092.1.g00470.1.am.mkhc 174 IAEETLAEFLSKATGTAVDWVQMVGMKPGPDSIGIIAVSHNCSGVAARACGLVSLEPT 231
                                     68999************************************************98775 PP

3START68.51.9e-22233315125204
                                     EEEEEEE-TTS--....-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHT CS
                           START 125 ivdvSvdseqkppe...sssvvRaellpSgiliepksnghskvtwvehvdlkgrlphwllrslvksglaegaktwvatl 200
                                     i+++S+++ +  p+   ++++vRae+lpSg+li+p+++g+s +++v+hvdl++++++++lr+l++s  + ++k++ a+l
  Zpz_sc00092.1.g00470.1.am.mkhc 233 ICERSLTQSTGGPSgpnTPNFVRAEVLPSGYLIRPCEGGGSMIHIVDHVDLDAWSVPEVLRPLYESPKILAQKMTIAAL 311
                                     899*****999999999*************************************************************9 PP

                                     XXXX CS
                           START 201 qrqc 204
                                     ++ +
  Zpz_sc00092.1.g00470.1.am.mkhc 312 RHIR 315
                                     9865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.3E-181183IPR009057Homeodomain-like
PROSITE profilePS5007115.4352084IPR001356Homeobox domain
SMARTSM003892.6E-152288IPR001356Homeobox domain
SuperFamilySSF466895.13E-172487IPR009057Homeodomain-like
CDDcd000862.00E-162585No hitNo description
PfamPF000463.7E-162683IPR001356Homeobox domain
CDDcd146862.96E-677116No hitNo description
SuperFamilySSF559615.04E-18174318No hitNo description
PfamPF018521.6E-6174232IPR002913START domain
PfamPF018526.7E-20233315IPR002913START domain
PROSITE profilePS5084812.499233298IPR002913START domain
Gene3DG3DSA:3.30.530.202.8E-7237287IPR023393START-like domain
PfamPF086705.9E-27556654IPR013978MEKHLA
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 659 aa     Download sequence    Send to blast
MVAAGGGKDR SSPGGGGAPQ VDTGKYVRYT PEQVEALERV YSECPKPSSL RRQQLIRECP  60
ILSNIEPKQI KVWFQNRRCR EKQRKEASRL QTVNRKLTAM NKLLMEENDR LQKQVSRLVY  120
ENGYMKQQLH NPSVATTDTS CDSVVTSGQH HQQQNPAAPR PLRDANNPAG LLAIAEETLA  180
EFLSKATGTA VDWVQMVGMK PGPDSIGIIA VSHNCSGVAA RACGLVSLEP TKICERSLTQ  240
STGGPSGPNT PNFVRAEVLP SGYLIRPCEG GGSMIHIVDH VDLDAWSVPE VLRPLYESPK  300
ILAQKMTIAA LRHIRQIAHE SSGEMPYGGG RQPAVLRTFS QRLSRFVNIN VPPALLVRFL  360
REHRSEWADP GVDAYSAAAL RASPYAVPGL RASGFMGSQV ILPLAHTLEH EELCSGVDEN  420
AAGACAQLVF APIDESFADD APLLPSGFRV IPLDAKTDPP SGTRTLDLAS TLEVGSGGTT  480
RASSDASSTS STRSVLTIAF QFSYENHLRE SVAAMARQYV RTVVASVQRV AMAIAPSRIG  540
GQLEMKQTPG SPEAQTLARW IGRSYRFHTG AELLRTETPC TDSSLKALWQ HSDSIMCCSL  600
KAAPVFTFAN QAGLDMLETT LIALQDISLE KILDEDGRKA LCSEYPKIMQ QACTNHRYF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1032840.0AK103284.1 Oryza sativa Japonica Group cDNA clone:J033124M18, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006592258.10.0PREDICTED: homeobox-leucine zipper protein REVOLUTA-like
SwissprotA2ZMN90.0HOX33_ORYSI; Homeobox-leucine zipper protein HOX33
SwissprotQ2QM960.0HOX33_ORYSJ; Homeobox-leucine zipper protein HOX33
TrEMBLA0A0E0FEF60.0A0A0E0FEF6_9ORYZ; Uncharacterized protein
STRINGGLYMA12G08080.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP3734923
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G34710.10.0HD-ZIP family protein